BEEP BEEP - Edition>What is /wvt/?/wvt/ is a thread for viewers to find, share, and discuss English-speaking VTubers.Include a picture and a link so we know who they are and how to watch!>Twitch Clips Guidehttps://pastelink.net/34vd5>Koikatsu cardshttps://mega.nz/folder/bVhChYJL#A9eJFTFmA0xTKeag_ZgbTQ>Ref Sheetshttps://drive.google.com/drive/folders/1GqDE0jDIFNw_GyHyHW4qA_ndlaHyXqFv>Chickenshttps://www.twitch.tv/ourchickenlife>Previous thread>>24141627
>>24201013https://www.twitch.tv/veleckshe's playing rimworld today!
KUMA KUMA KUMA
>Nina and Kitanya both cancelled their streams todayTHEY ARE hopefully resting well and taking some much earned time for themselves
Nade love!
https://twitch.tv/petiteneetBased bnuy
It's Friday lads who you perceiving?
For me, it's the rrat
I love this dog like you wouldn't believe!
>>24202154Ikumi got a nice pair...
SEX WTIH ______________
What kind of asmr do you like hearing from a chuuba (forma de female) asking for a friend.
sneep
>>24202958ryona
>>24202958Realistic kissing noises. None of JAV slurping shit
>>24202958I mostly like soft spoken stuff, maybe some brushing as long as the mic can handle it. For me it's more about the gentleness.
>>24202958Positive affirmations, sharp sounding words (b's, p's, k's, g's do wonders)Whispering and soft voices, gently tapping the ears, blowing air softly.Some easy ones include stuff like typing on a clicky keyboard, turning pages, writing on paper, anything that makes crisp sounds.
>>24202958Soft gentle stuff. It can be talking, messing around with a brush, softly blowing air, kisses that kind of things
>>24202958Something about hugs specifically gets to me
>>24201643Gorls off collab when?
https://www.twitch.tv/josabelledemonthe cute imp huntress is on with some SNES horror games!
https://www.twitch.tv/letaniavtcute OL hagpire's doing a sekiro challenge run today!
https://www.twitch.tv/freidanoxloud goat demon woman's playing some hollow knight!
>>24203671Anything to get Neko and Tanya out of South Africa.
>dono goal is buying and building a katanathat actually sounds like a really cool crafting stream ideaweaponsmith chuuba when?
>>24204468Atropa kind of fits that bill?
>>24204468Atropa is pretty close
who is in desperate need of fanart
>>24201013LittleHybridhttps://www.twitch.tv/littlehybridvtDommy autistic girl calls people in chat good boys sometimes.https://www.twitch.tv/littlehybridvt/clip/GeniusSpikyToothJebaited-uBHq1PNTgQ-tS-OkFound her recently very small average 10 viewers. Very lewd yet surprisingly wholesome. Very comfy.Shes like halfway between models so shes using a jpg rn.
>>24204833are you g*el or another art friend?
>>24205014I will take that as a no
>>24201013Watch Furuya Mari's very 1st Monetization Stream!https://www.youtube.com/watch?v=t9gPishm86I
https://www.twitch.tv/nyaruchuuucaramel idol's taking a look at your rooms!
>>24204468Atropa, but in a "Oh God what have you done!" sort of way. She got drunk the other day and started harassing Brandon Herrera on Twitter while posting guns she painted.
nyaru bedroom tourshttps://www.twitch.tv/nyaruchuuu
https://www.twitch.tv/purityvalentineeyepatch cat's doing more work on her chat mascot art!
https://www.twitch.tv/acriusoakeshottacrius is going to massacre hogwarts in elden ring!
https://www.twitch.tv/torakkovtsukeban oni's on with bugsnax!
https://www.twitch.tv/nekoreensafa cybercat's on with some pokemon firered!
>>24205690>ISP still being a shitgoddamnit let the cat stream
Cute dorky spider continuing KOTORhttps://youtu.be/sfqV3c0fFSc
https://www.twitch.tv/eira_chcute welsh sheep's continuing her MGS1 run!
https://www.twitch.tv/miyuyusditzy sloth's on with portal 2!
https://www.twitch.tv/sheriffdancesheriff dance's playing some red dead redemption 2
>>24205879PLEASE SOMEONE EXPLAIN WHY IS IT TOADS INSTEAD OF ROADS, THIS IS DRIVING ME ABSOLUTELY INSANE
>>24205906it's an edit
>though I'd have to struggle balancing nina, tanya, and neko streams all happening at once today>nina and tanya cancelled, neko's internet is fucked
>>24206006Oh wow, this whole time I just thought it was typo humor.
>>24206557It is, though.The original song says "country roads".
>>24206519I'm glad they're taking time off to take care of themselves. It eases my concernfag mind, if only a little.
https://www.twitch.tv/kalmia_amanitagarage kit owl's on with dune: spice wars!
Foks loev.
>>24206006Thank you, I did not have the context and it was driving me insane for like two months
Cute serial killer imouto celebrating Friday the 13th with karaoke todayhttps://www.twitch.tv/alicesawyer
https://www.twitch.tv/bodega_rratOops all art! Live now!
>>24208487can you link her in the back office too
>>24208607I’ll link my fist to your ballsack you little freak
>>24208709why
>>24208607No.
why are you guys so hostile today?
>>24208487this is a truly wonderful rrat
>>24208972because fuck you that's why
>>24209017why??? was using /an/ rat pics to shill her offensive or something...?
>>24209066No, but she left the back desk, and if people who only post there and not here want to watch her, they can get notified by twitch
>>24209613>twitch notifications
>>24208972anon, crypto market just crashed, be understanding, they have to wash toilets at wendy's now
>>24209686Wendeez nuts
>>24209686wasnt that annoying oil groomer a crypto guy?
>>24209774Sure was, hope he's having an awful day
>>24208972That's Friday the 13th for ya
>>24209923He'll drop 5k on each of your oshis just to rub it in your face
>>24210562That would be great, they could use the money, unfortunately he only orders skebs now
>>24210562Good. Give the money to someone else.
>>24210611Sad, a lot of people could use his money. Skebs are worthless since it only shows off a vtuber's design and not what they're actually like.
https://www.twitch.tv/spike_adthe local rock'n'roll racer's on with some diddy kong racing!
https://www.twitch.tv/eggchegg's playing more fallout: new vegas!
>>24205625She turned Beffica into a pickle! Funniest shit I ever seen
>>24202906
>>24202906Sex with >>24211586
Thank you for cheering me on! We're so close to the no-death Shura ending, I can smell it! Good night!
>If you don't win, I'll cry.>You have to eat more!Wow Eira is just like my real mom.
>>24211713you've got this, hagpire! rest well!
https://www.twitch.tv/leonidasumbrashadowcommander's on with some 2hu
https://www.twitch.tv/atropaeverwoodgun nut forest witch's on with some tarot readings!
>>24212285oh my god she's wearing a maid outfit.
>>24212343she's WHAT?
>>24212390She's wearing a corset, too. GODDAMN.
>>24212390WEARING A MAID OUTFIT
>>24212507She wears those often, doesn't she?
I like this dork
Reminder
>>24204833Charlotte, though I know you won’t deliver
>>24213065not that anon but I'll draw something quick. don't expect quality though. anything in particular you want?
>>24213104charlotte stuttering about dinosaurs for two minutes before leaning in for a kiss
>>24213192This.
Hils playing Visagehttps://www.twitch.tv/hils
https://www.twitch.tv/charlottexbearCharlotte's playing Call of Cthulu
>>24213104POV of Charlotte's reaction to (you) finishing inside.
>>24213065you're 4 hours too late I drew someone else
>>24213304thanks for shilling on both threads honeybear
>>24213192
>>24214103based
>>24214103this is so cute...
>>24214103can't wait for her to see this, super cute
>>24214103Adorable
>>24214424Link it in her chat, I dare you.
>>24214462link it to her yourself, coward
>>24213304>>24214103luv this bear
>>24214462don't distract from the stream like that, I'm sure she'll see it afterwards
https://www.twitch.tv/akiajimargochsweet potato saleswoman's on with cave story!
I liked Alice's previous model better.
https://www.twitch.tv/henemimifunny chicken's playing more peace walker!
Nightmare sheep 6 month anniversary celebrationhttps://youtu.be/QDh3yYO6UVg
https://www.twitch.tv/lunellavt
>>24215472No "support my oshi"?Not even an image?https://www.twitch.tv/lunellavtSupport this guys oshi.
https://www.twitch.tv/guardianzetforest halfling's on with 2hu
lol
>>24216564Filipino government coming after Randon
>>24216564Why though?
>>24216678last month he consistently broke 1kthis month he hasn't broken 500 >numbersfaggingYes.
>>24216036So pretty ^_^
>>24216791Were those numbers on youtube? Because those sound like fantastic numbers to me.
https://www.twitch.tv/waabyuuWaabyuu singing to celebrate partner! Will collab later.
>>24216791>Numbersfag>Not streaming on TwitchIt's not that I don't believe you anon but I find it very unlikely that a real numbersfag that would go manhera over this would stream on Youtube over Twitch
>>24216791Is this a thing he said or a thing you're assuming
>>24217620how is it the first time i hear of that one
>>24217551He switched to Twitch.
>>24217693She's not /here/ and doesn't talk with anyone /here/ so not even adjacent.Are you liking her singing, anon?
>>24216678Found a boyfriend, rebranding to be with him.
>>24217694Those numbers sure as hell weren't on twitch, which is why I ask.
https://www.twitch.tv/niceeggyopera eggy's on with some sewing!
>>24216036Gonna steal this guys oshi and he can't stop me.
>>24217620funny watertoo bad I had to drop her because she streams at the same time as my oshi
>>24217775its the kind of stream i prefer
Someone explain to me the bat's trick with Morika.Is it someone behind the voice or some clever TTS bot?
>>24218099>TTSLmaoIts obviously someone new.
>>24218099Morika is usually played by Moriko on special streams but since she can't play to characters at once it seems like Morika is being played by Grape, kind of fits to be honest
>>24218128>>24218409Thanks for explaining.First time watching Morika live, she's literally sex.
>>24218525This was posted by Bat back in December, It's canon that Morika fucks
Why does Aki moan and grunt all the time?
>>24218616Oh yeah, she an airhead bimbo
https://www.twitch.tv/profbloomvtuberthe local choir professor's on with some yo noid 2 practice runs!
>>24216564He got into Nijisanji/Holostars
Bat sisters playing amogus
https://www.twitch.tv/rummythebossrummy corpse party
>>24219874Who
https://www.twitch.tv/gondola_gamingvtgondola's doing an EDF 4.1 collab!
>>24217620she sounds like goora
https://www.twitch.tv/koragi_chkoragi's playing taiko no tatsujin!
>>24220122W-who's Ryouta?
>>24219915Moriko and her sister Morika
>>24220332A bird. In actuality, her viewers use his name instead of "anonymous" when purchasing stuff on her throne.
>>24220332Me.
https://www.twitch.tv/cloverchibiclover's playing more undertale!
https://twitch.tv/laranbonnieLoli rabbit is BACK with Action Taimanin.
https://www.twitch.tv/maplewintersthis maple wood elf's doing karaoke tonight!
>>24216564>>24216791that's fucked... i wanted to check him out...
https://www.twitch.tv/corpse_chcorpse is on with some more salt and sanctuary!
>>24221860C'mon anon, you probably have multiple chuubas in your backlog. This was bound to happen.
Straight-up karaoke room background... comfy...
https://www.twitch.tv/mintcastellafunny hagdog's playing MGS!
>>24222308She needs to stop teasing and show us her belly button.
EATANDRINKANPLAYANWATCHANFEELAN
https://www.twitch.tv/sigridandbirdsigbird hunt
https://www.twitch.tv/tiredsquiddsquid's on with some FO2
>>24208487thank you for linking me!!!>>24209613is the point for me to notice the link? I thought the point was for viewers who prefer that thread to be notified? I'm not always on twitch and sometimes this thread lets me know when someone is on, so I imagine its the same for some people in the back.Either way I really appreciate the links>>24223110>EATANMAKAN DINNER>DRINKAN WATER>PLAYANCOOKIN>WATCHANMY OOSH https://www.twitch.tv/goldenkenji>FEELANbretty nicehope your friday night is nice
>>24218409That's Basedapoya.
Meru karaokehttps://youtu.be/YRq9b6pH4ls
I normally don't self post, but i had a unusual amount of lurkers today, so wanna thank any of yall that came out to watch the first of my Civ 6 runs. Appreciate it, and hope yall are having a great day!
https://www.twitch.tv/calliecalicothe house arrest magical girl's on with evil dead: the game!
Friday the 13th horror sttream, playing Lost in Vivo, planning to projectile shit myselfAlso cuter edition uwu new edits to deformershttps://www.twitch.tv/creamycewl
https://www.twitch.tv/midnightjesperbioshock with jester jesper
https://www.twitch.tv/kotomisnacksthis cute southern belle goat's doing a getting stuffed! collab
https://www.twitch.tv/eira_chwelsh seep's on with elden ring! (i didn't realize she wasn't just switching games, my bad...)
>>24219368Thanks anon! Gonna grind Jones' bones to make my bread tomorrow. I will prevail as the one true Noidtuber.
https://www.twitch.tv/shadydesu_chvoidbro's playing DKC2!
https://www.twitch.tv/grimmivt dropsy, this time for real
https://www.twitch.tv/tomakeys funke munke's on with earthbound!
>>24205442Post the other ones
https://www.twitch.tv/kkcybercyber tenshi's on with some ASMR
SHES LIVE
>>24201487why are you guys lying to kuma? she sucks so bad at singing.>If I didn't like your singing, I'd leave.>I love Kuma's singing voice> Bear singing is so goodAND the music is too fucking loud
>>24234157She's got a very good voice
>>24234157Just because someone’s bad at singing doesn’t mean they’re bad at singing
>>24234157But I do like her singing.
>>24234073Why does she sound so souless now? What happened to her?
>>24234751*****
>>24234409technical proficiency does not make a performance entertaining; energy does
https://www.twitch.tv/junii_hejjikohigh hedgehog's playing some sonic 1
>>24234751I did.
>>24235217Banana...
>>24221520Thank you Anons who checked my stream! I'm happy to be back. Hope to see you next time.
>>24235849I missed you, welcome back !
God is cute.
https://www.youtube.com/watch?v=gauMAfUDY4UNarumi Mihama, a totally new Vtuber no one has ever seen before, is about 60 subs away from 4k.
>>24238573
I like her.
>>24238573Is this the fart girl?
>>24220332it was all me for a while, some other kemonodachi keeping the dream alive is nice though.
>>24240086F-fart girl?
Good morning are you perceiving chuubas if not why not
https://www.twitch.tv/carmine_chcool chunni's on with more A Link to the Past!
>>24241849doing reps
>>24242492damn they sent tokino sora to the war?
>>24241849No. Too buzy being lazy in bed while listening to a viewer over discord.
>>24214103Ahhhh this is incredibly late but THIS IS TOO CUTE! Ahhh my face and ears feel a bit hot t-thank you Hanabi! Your art always makes me smile and this is just way too adorable.Also um, thanks for watching if you did, endurance streaming can be fun! I know I always ask this, but don't hesitate to give criticism or feedback! I really wanna improve and get better! I can't properly say good night yet because I have blondies in the oven, but I hope you have a wonderful night /wvt/!
https://www.twitch.tv/paperbag_chbaeg risk of rain 2
>>24243178I like Bag
>>24242991scroll down his funny bird app, he posted it there too
>>24241849I was asleep watching grimmi
Koopa lookin kinda weird.
>>24245544bloopa...
>>24245960i want to hold bloopa on my shoulders while at my favorites band concert!
>>24243549He's cool
>>24242991Someone mentioned this a while ago, but consider reaching out to Orla for a true Schizo conspiracy collab
>>24246664I want to throw Bloopa into the middle of a mosh pit
LIVE IN 10!The schedule may as well be a loose suggestion at this point.We're doing Rogue Legacy 2 because starting an XCOM campaign before I go down the Outward Definitive Edition rabbithole next week is probably not the best idea.twitch.tv/calebhorusvt
>>24213065
>>24249619cute
>>24249619Good work.
>>24201013neat
return of crowd control: clown control edition, this time in call of pripyat (mod merge 2015)https://www.twitch.tv/woozle_ch
Comfy Karaoke timehttps://www.twitch.tv/nadechama
>>24252230>>24250701
Are there any actual western VTubers that aren't just a bunch of weebs?
>>24253026yeah me
>>24253026There's several tens of thousands of vtubers out there. Probably yes. There's at least two who go for a 1930s cartoon aesthetic, one of them being heavenstobetsy and I forgot the name of the other one. Kabhaal is themed after a Tales from the Crypt storyteller. Power Nelson is literally a public domain comic book super hero from the 1940s. Just off the top of my head. Most of them are probably weebs to some degree just because the entire appeal of vtubers is anime becoming real.
New pandahttps://youtu.be/kNvurHd5Ivs
>>24253026Nelson is a known weeb hater
rrats?
https://www.twitch.tv/mashimyu_chmyu
>>24254727Becoming a corpo
i was gonna post something then i forgor
>>24254932If he was becoming a corpo why say retiring from vtuber activities? That's just lying at that point.
>>24255265New viewer????
>>24255265Would be the first time someone lied when becoming a corpo
two old men race a 30-year-old pizza mascot game for honor and gloryhttps://www.twitch.tv/all_bonesjones
>>24252162thanks for dropping by, sorry for the short stream but I really wanted to watch this >>24258452 stupid sack of shit get his bones ground for bread
>>24259293jones pizza?
Jones please prepare next time...
>>24259995can't believe I ended early for this...
>>24260120Woozle...
https://www.twitch.tv/profbloomvtuberthe local choir professor's doing more yo noid speedrunning practice!
>>24260285actually bloom has to try and host the noid race because the discord update is practically bricking jones' toaster>>24260274meh wasn't feeling it today anyways
>>24254727Menhera over not being accepted into a corporation
>>24260593Like Nina?
https://www.twitch.tv/kalmia_amanitagarage kit owl's finishing up escape from monkey island!
>>24254727Either going manhera over something (numbers or not getting into a corpo) or going to jail. I REALLY doubt he's going corpo.
>>24254727Kek, it’s hard for me to see him joining Holostars but he is pretty wholesome so maybe? Still, the language makes me think otherwise
going live with Ready or Not!https://www.twitch.tv/veleck
>>24261775what's ready or not?
>>24261861nta but I think it's like those old SWAT games
>>24261861i think it's a police sim like SWAT
>>24261227Why would he go to jail?
>>24262064It's the only plausible explanation for a sudden graduation out of the fucking blue after everything was fine 24 hours ago.Either that or manhera episode.
>>24262523He's pregnant, calling it now.
>>24262523he successfully groomed the chuuba he was after
>>24263261i can't see him grooming someone
>>24264188damn, he's good
>>24264188It was Corpse. That's why he's retiring now, with Corpse's Cytube Collabs
https://www.twitch.tv/hnzw_quiet florist hyena's finishing up her eurovision 2022 watchalong today!
Having a good weekend? You could make it better by perceiving chuubas.
>>24265074Thumbnail made me think she went full /meat/ on her hand
https://www.twitch.tv/leonidasumbrashadowcommander's cooking chicken teriyaki today!
https://www.twitch.tv/elliottambersthe math teacher tactician's on with some Civ V!
https://www.twitch.tv/lumituberDONE WITH MY CHORESLUMI TIME
>>24258452>>24260285Despite technical issues, we got through it! Can't believe I blew it so bad in Noid 1 but had such a clean Noid 2. RIP Jones' PC, Discord sucks. I am looking forward to Jones' noid outfit, though!
>>24261861it's a fun early access game where you're in a SWAT team!can be played either single player or multiplayerit's surprisingly tense!
Nina is streaming the crab game collab on discord
who should I draw for reps today
>>24267701the noid
>>24267701woozle getting bonked with a comedically large hammer
>>24267648I love Nina so much, bros.
>>24267465good shit professor!
>>24267741
>>24268367thats some good shit
>>24268367I need someone to edit mc ride's screams with the noid's NOW
>>24267465HOLD IT, BLOOM! This race was rigged from the start! Jones' emulator gave him a speed advantage, so even though he lost, this race is NULL AND VOID! I have proof!https://files.catbox.moe/kugdb2.mp4
>>24268917>losing with an advantageJones...
It's only been a few days but I missed this fox and she's playing Ace Attourney!https://www.twitch.tv/kitanya_is_here
>>24268917>Not typing VULL AND NOID
>>24269016Luv foks
https://www.twitch.tv/acriusoakeshottacrius is on with some more order of ecclesia today!
The sheeping is sneepinghttps://www.twitch.tv/eira_chPlaying Sonic Adventure 2
https://www.twitch.tv/eira_chcute welsh sheep's playing more SA2!
https://www.twitch.tv/ha0nkha0nk ha0nk it's redwall time
>>24269086Great stream guys
https://www.twitch.tv/shadydesu_chvoidbro's playing some smash bros with axecutioner before another kirby anime watchalong!
Guess I'll go have a snack in the meanwhile.
>>24268947but he did not have any in the second game
>>24269016>>24269086>>24269417Delayed for an hour.
>>24268917I can't(otally) believe jones had done this
>>24217689He fell for the YouTube bait early last year where people were so sure YouTube was the better streaming platform. At one point he even admitted twitch was better and still stayed on YouTube out of basically stubbornness and he moved too late. I think he just got too drunk on the "YouTube will give us all the things twitch has" Kool aid and regret it. Or he's joining a corpo, I can honestly see that too. It'd be interesting to see how well a traditional "content" focused vtuber does, something similar to Ludwig who streams with the intent of making videos.
Thanks for coming by the stream, hope you had a good time!Man, I'm gonna miss becoming a hobo camp God once they nerf it in Outward's Definitive Edition.Using up a city's whole-ass real estate is much too satisfying
shes so cute...
>>24270148I don't recognize this one and can't find her in the vtuber tag. Whomst?
>>24270310i don't think that anyone here is her target audience. she speaks korean on the streams but i don't care because she sounds really nice and does lots of karaoke
>>24270535Fair enough. She does look cute.
>>24270535There are many here that can understand Korean, shill her.
>>24268917imagine cheating and losing lmao
>>24269016Starting now https://www.twitch.tv/kitanya_is_here (embed)
Round 2!https://www.twitch.tv/kitanya_is_here
>>24270535Link her, good listening practice.
>>24271379Teeth
Beri Binding of Isaac endurance streamhttps://www.twitch.tv/ladybug_beri
https://www.twitch.tv/gaelstratusgael's on with rimworld
>>24271575>upper teeth moves and lower stays stillshouldn't it be opposite?
https://www.twitch.tv/ariarinchanzonked rimworld with mecharia
now thats a big collab
>>24271763That dude in the bottom right has a really detailed model.
>>24271763I love how it's a bunch of big/mid sized names then two guys who managed to slip in because they have high twitter numbers
https://www.twitch.tv/paninis this chuuba playing super seducer
https://www.twitch.tv/spike_adthe local rock'n'roll racer's playing some MS DOS driving games!
>>24253865>dig up an old forgotten super hero>drag his name through the mudNelson has no shame
>>24272119spike is cool!
https://www.youtube.com/watch?v=TZpLa2cLNC4Kiki is playing castlevania!
>>24272080She cute but her mic picks up plane sounds very frequently
https://www.twitch.tv/hauntvaniaghostie and vampoyo are playing some phoenix wright!
>>24272867how do people end up living in noisy places? no one should have to live in a place that has noise problems
>24272815
>>24273300Redlining, being born there, somehow don't mind the noise, etc.
>>24273381it feels like a very american issue. theres everything from vehicles to fucking government installed horns. here it is always dead silent
Belly
>>24272761Spike is such a top lad
pinpon event
>>24271667What you are asking for is a whole lot more articulation in the lower jaw to form mouth shapes. Most chuuba rigging focuses mainly on the mouth itself for shapes with very subtle lower jaw movement.
>>24274171bad event unironically but i guess she does everything ironically
>>24274483it's just an excuse to have a long stream with the "subathon" part being a shitpost I'll probably drop 10 subs anyway
high quality
>>24274893god fucking damn that model is awful looking
Good evening. I'm live with another Snake Saturday. Please come by and watch me explore modded Skyrim's dangerous, dark tombs filled with unfortunate souls bound to this plane beyond their time. https://www.twitch.tv/cadenceharper
https://www.youtube.com/watch?v=5mZ_hBIf-Y4 duroppu - temtem
https://www.twitch.tv/walfasWalfie is a whoooooooooooooreLet me cum raw inside his bussy!
>>24275252haven't heard anything about her since all that drama with her old corpo. How's she holdin up? I think she was in the hospital back then so I hope whatever that was about went well too.
>>24202157WHORE
>>24204951Who is this cutie?
